Pay in 4 interest-free payments of $7.26 Learn more
Ships within 48 hours · Estimated delivery Aug 12 - Aug 17
Synonyms : NN0174-0833, AM833, EXA10092 Product Specifications CAS Number : 1415456993 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Weight : 4409 g/mol Chemical Formula : CHNOS Purity : Typically supplied at 98% purity by HPLC
Both options are available at Harmony Health Clinic, and the right choice depends on patient goals
Certificate of Analysis Every batch of BPC-157 sold by Pepspan undergoes rigorous third-party testing
Additionally, we noted this approach could contribute to successful participation in the REHQR Program, while still requiring REHs to report timeliness of ED care metrics
It's essential for individuals with fibromyalgia to work closely with healthcare providers experienced in pain management to develop a personalized treatment plan
US$ 21.09
US$ 24.27
US$ 24.45
US$ 28.52
